PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV14968.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family ARF
Protein Properties Length: 864aa    MW: 96482.9 Da    PI: 6.2787
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV14968.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B367.51.9e-21143239192
                 EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                 f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++g++W++++i+r++++r++l++GW+ Fv++++L +gD ++F + ++ +f +
  KZV14968.1 143 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRFDSYSFPC 239
                 99*****************************7333.34459***********************************************9665566655 PP

2Auxin_resp116.32.6e-38293375183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha++tks F v+Y+Pr+s++eF+++++++++++k ++s+GmRfkm+fe+e+++e+r++Gt+vg++d+dp rW +SkWr+Lk
  KZV14968.1 293 AWHAVQTKSLFIVYYKPRTSPAEFIIPFDQYMESVKYNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPKRWAESKWRCLK 375
                 89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.53E-35139296IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.8E-36140282IPR015300DNA-binding pseudobarrel domain
CDDcd100174.43E-19141239No hitNo description
SMARTSM010192.4E-18143246IPR003340B3 DNA binding domain
PfamPF023629.8E-20143241IPR003340B3 DNA binding domain
PROSITE profilePS5086310.602143245IPR003340B3 DNA binding domain
PfamPF065073.1E-35293375IPR010525Auxin response factor
PfamPF023092.0E-9726825IPR033389AUX/IAA domain
SuperFamilySSF542774.61E-10735815No hitNo description
PROSITE profilePS5174523.3738820IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 864 aa     Download sequence    Send to blast
MDSSEVLIKG CNEVNDCDSR SEMGSLGTGK VDAEMALYTE LWKACAGPLV TVPRKNELVF  60
YFPQGHIEQV EASTNQTADQ QMPVYNLPPK ILCRVVNVDL KAEPDTDEVY AQVTLMPEPE  120
QDENAVKKEP VPPPPPCFHV HSFCKTLTAS DTSTHGGFSV LRRHADECLP PLDMSRQPPT  180
QELVAKDLHG NEWRFRHIFR GQPRRHLLQS GWSVFVSSKR LVAGDAFIFL RFDSYSFPCN  240
FLYRSSAFFK SVLFRGENGE LRVGVRRAMR QQGIAPSSVI SSHSMHLGVL ATAWHAVQTK  300
SLFIVYYKPR TSPAEFIIPF DQYMESVKYN YSIGMRFKMR FEGEEAPEQR FTGTIVGIED  360
ADPKRWAESK WRCLKVRWDE ISTISRPDRV SPWKIEPALS PPALNPLPVS RHKRPRSNVL  420
PSSPDSSVLT REGPSKMTVD PSPAGGFPRV LQGQELSTLR GNNESDSSEK PLLLWNPPLV  480
DDGKIDASAS RRCGSEKWLP LGRSESSFTD LLSGFGLQVN SPRDFCLPPV DQMTSKRVAQ  540
VREDKFNLTG NTWSTVPSGF SLNLMDSSLN THGQGADTSF QTQGDARYGA FRDFSIIHDP  600
KSENQQANWL MPPPVSPFPQ ISSQSREMIP KSLFTKQHDA MKLNEGSCKL FGFSLLSDST  660
PLDAPMPRAN VIGALGHVQY GKHIHETPAI ESDQSSSDQV KATKLVDPFA TNEQEKQFKT  720
FNVVSRERES KGHSGSTRSC TKVHKQGTAL GRSVELAKFG NYSELISELD NLFEFDGELK  780
ARTSDWLVVY TDDEDDMMLV GDDPWEEFCG MVRKILIVTK EEVQRMNPGT LISKGEETSS  840
VAEGTDAKDM KNIPTTSSSN LGDC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1663639718354Auxin response factor 1
4ldw_A1e-1663639718354Auxin response factor 1
4ldw_B1e-1663639718354Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011073189.10.0PREDICTED: auxin response factor 2-like
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLA0A022Q1X60.0A0A022Q1X6_ERYGU; Auxin response factor
STRINGSolyc03g118290.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA26182444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2